PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013626994.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 343aa    MW: 39448.9 Da    PI: 6.5957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013626994.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+d++k++G g+W+t ++  g+ R++k+c++rw +yl
   XP_013626994.1 14 KGPWTSEEDQKLLDYIKKHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding521.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
   XP_013626994.1  67 RGRFSFEEEETIIQLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129424.964965IPR017930Myb domain
SuperFamilySSF466893.25E-3111108IPR009057Homeodomain-like
SMARTSM007172.9E-131363IPR001005SANT/Myb domain
PfamPF002495.1E-161461IPR001005SANT/Myb domain
CDDcd001671.50E-121661No hitNo description
Gene3DG3DSA:1.10.10.605.3E-2665116IPR009057Homeodomain-like
PROSITE profilePS5129419.23466116IPR017930Myb domain
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002496.4E-1567111IPR001005SANT/Myb domain
CDDcd001671.63E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDQKLLDYIK KHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG  120
IDPMTHSPRL DLLDISSILA SSLYNSSSRH VNMSRLMMDG HRQHQQQQPL VNPEILEVAT  180
SLFSQNQNQN FVMDHDSKTH DNHTSYHHDV NQTGVNQYQT NHQELQYCLP PFPSEAHIND  240
MDHHGEHTFA LNLNTSVQDC DIQLFNDYAS SNFVLDHSYL DQSFNFADSV LNTPSSSPTT  300
LNSSATTYIK SSSCSIEDEI ESYCSNFIKF DIPDFLDVNG FII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0872520.0AY087252.1 Arabidopsis thaliana clone 33333 mRNA, complete sequence.
GenBankAY5196070.0AY519607.1 Arabidopsis thaliana MYB transcription factor (At4g21440) mRNA, complete cds.
GenBankBT0012350.0BT001235.1 Arabidopsis thaliana myb-related protein M4 (At4g21440) mRNA, complete cds.
GenBankX903820.0X90382.2 Arabidopsis thaliana mRNA for putative transcription factor (MYB102 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626994.10.0PREDICTED: myb-related protein 315-like
TrEMBLA0A0D3BKR00.0A0A0D3BKR0_BRAOL; Uncharacterized protein
STRINGBra020892.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-164MYB-like 102